Lineage for d6ftlc1 (6ftl C:3-153)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2519829Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2520025Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2520026Protein automated matches [226983] (24 species)
    not a true protein
  7. 3053852Species Skeletonema marinoi [TaxId:267567] [353914] (1 PDB entry)
  8. 3053957Domain d6ftlc1: 6ftl C:3-153 [354019]
    Other proteins in same PDB: d6ftla2, d6ftlc2, d6ftle2, d6ftlg2, d6ftli_, d6ftlj_, d6ftlk_, d6ftll_
    automated match to d1bwva2
    complexed with cap, edo, mg

Details for d6ftlc1

PDB Entry: 6ftl (more details), 2.6 Å

PDB Description: rubisco from skeletonema marinoi
PDB Compounds: (C:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6ftlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ftlc1 d.58.9.0 (C:3-153) automated matches {Skeletonema marinoi [TaxId: 267567]}
qsvsertriksdryesgvipyakmgywdasytvkdtdvlalfritpqpgvdpveaaaava
gesstatwtvvwtdlltaceryrakayrvdpvpnsadvffafiayecdlfeeaslanlta
siignvfgfkavsalrledmriphsylxtfq

SCOPe Domain Coordinates for d6ftlc1:

Click to download the PDB-style file with coordinates for d6ftlc1.
(The format of our PDB-style files is described here.)

Timeline for d6ftlc1:

  • d6ftlc1 appears in periodic updates to SCOPe 2.07 starting on 2018-06-28