Lineage for d6ftlj_ (6ftl J:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524228Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2524229Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2524488Family d.73.1.0: automated matches [336551] (1 protein)
    not a true family
  6. 2524489Protein automated matches [336552] (6 species)
    not a true protein
  7. 3053850Species Skeletonema marinoi [TaxId:267567] [353912] (1 PDB entry)
  8. 3053870Domain d6ftlj_: 6ftl J: [353932]
    Other proteins in same PDB: d6ftla1, d6ftla2, d6ftlc1, d6ftlc2, d6ftle1, d6ftle2, d6ftlg1, d6ftlg2
    automated match to d1iwab_
    complexed with cap, edo, mg

Details for d6ftlj_

PDB Entry: 6ftl (more details), 2.6 Å

PDB Description: rubisco from skeletonema marinoi
PDB Compounds: (J:) ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit

SCOPe Domain Sequences for d6ftlj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ftlj_ d.73.1.0 (J:) automated matches {Skeletonema marinoi [TaxId: 267567]}
mrltqgcfsflpdltdaqiekqvayamakgwamnvewtddphprnnywelwglplfdikd
patvmfelnearkscaagyirinafdasygvescvmsfitnrptnepgfyldrtdgpgrq
ivysiksysvqanpegsry

SCOPe Domain Coordinates for d6ftlj_:

Click to download the PDB-style file with coordinates for d6ftlj_.
(The format of our PDB-style files is described here.)

Timeline for d6ftlj_:

  • d6ftlj_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-28