Lineage for d6ftla2 (6ftl A:154-484)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424105Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2424106Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2424311Protein automated matches [226984] (14 species)
    not a true protein
  7. 3053854Species Skeletonema marinoi [TaxId:267567] [353916] (1 PDB entry)
  8. 3053875Domain d6ftla2: 6ftl A:154-484 [353937]
    Other proteins in same PDB: d6ftla1, d6ftlc1, d6ftle1, d6ftlg1, d6ftli_, d6ftlj_, d6ftlk_, d6ftll_
    automated match to d1bwva1
    complexed with cap, edo, mg

Details for d6ftla2

PDB Entry: 6ftl (more details), 2.6 Å

PDB Description: rubisco from skeletonema marinoi
PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6ftla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ftla2 c.1.14.1 (A:154-484) automated matches {Skeletonema marinoi [TaxId: 267567]}
gpatgiivererlnkygtpllgatvkpklglsgknygrvvyeglxggldflkddeninsq
pfmrwrerflncmeginrasaatgevkgsylnitaatmeevykraeyakavgsivvmidl
vmgytaiqsiaywarendmllhlhragnstyarqknhginfrvickwmrmsgvdhihagt
vvgklegdplmikgfydilrltelevnlpfgiffemdwaslrrcmpvasggihcgqmhql
ihylgddvvlqfgggtighpdgiqagatanrvalesmvlarnegvdyfdqqvgpqilrda
aktcgplqtaldlwkdisfdytstdtadfae

SCOPe Domain Coordinates for d6ftla2:

Click to download the PDB-style file with coordinates for d6ftla2.
(The format of our PDB-style files is described here.)

Timeline for d6ftla2:

  • d6ftla2 appears in periodic updates to SCOPe 2.07 starting on 2018-06-28