Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
Protein automated matches [226984] (16 species) not a true protein |
Species Skeletonema marinoi [TaxId:267567] [353916] (1 PDB entry) |
Domain d6ftla2: 6ftl A:154-484 [353937] Other proteins in same PDB: d6ftla1, d6ftlc1, d6ftle1, d6ftlg1, d6ftli_, d6ftlj_, d6ftlk_, d6ftll_ automated match to d1bwva1 complexed with cap, edo, mg |
PDB Entry: 6ftl (more details), 2.6 Å
SCOPe Domain Sequences for d6ftla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ftla2 c.1.14.1 (A:154-484) automated matches {Skeletonema marinoi [TaxId: 267567]} gpatgiivererlnkygtpllgatvkpklglsgknygrvvyeglxggldflkddeninsq pfmrwrerflncmeginrasaatgevkgsylnitaatmeevykraeyakavgsivvmidl vmgytaiqsiaywarendmllhlhragnstyarqknhginfrvickwmrmsgvdhihagt vvgklegdplmikgfydilrltelevnlpfgiffemdwaslrrcmpvasggihcgqmhql ihylgddvvlqfgggtighpdgiqagatanrvalesmvlarnegvdyfdqqvgpqilrda aktcgplqtaldlwkdisfdytstdtadfae
Timeline for d6ftla2: