SCOPe 2.08: Domain d6ftlc2: 6ftl C:154-484

Lineage for d6ftlc2 (6ftl C:154-484)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
   N-terminal domain is alpha+beta

6. Protein automated matches [226984] (16 species)
   not a true protein

7. Species Skeletonema marinoi [TaxId:267567] [353916] (1 PDB entry)

8. Domain d6ftlc2: 6ftl C:154-484 [354020]
   Other proteins in same PDB: d6ftla1, d6ftlc1, d6ftle1, d6ftlg1, d6ftli_, d6ftlj_, d6ftlk_, d6ftll_
   automated match to d1bwva1
   complexed with cap, edo, mg

Details for d6ftlc2

PDB Entry: 6ftl, 2.6 Å

PDB Description: rubisco from skeletonema marinoi

PDB Compounds: (C:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6ftlc2:

Sequence; same for both SEQRES and ATOM records:

>d6ftlc2 c.1.14.1 (C:154-484) automated matches {Skeletonema marinoi [TaxId: 267567]}
gpatgiivererlnkygtpllgatvkpklglsgknygrvvyeglxggldflkddeninsq
pfmrwrerflncmeginrasaatgevkgsylnitaatmeevykraeyakavgsivvmidl
vmgytaiqsiaywarendmllhlhragnstyarqknhginfrvickwmrmsgvdhihagt
vvgklegdplmikgfydilrltelevnlpfgiffemdwaslrrcmpvasggihcgqmhql
ihylgddvvlqfgggtighpdgiqagatanrvalesmvlarnegvdyfdqqvgpqilrda
aktcgplqtaldlwkdisfdytstdtadfae

Timeline for d6ftlc2:

• d6ftlc2 first appeared in SCOPe 2.07