SCOPe 2.08: Domain d6f4jb_: 6f4j B:

Lineage for d6f4jb_ (6f4j B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [353673] (1 PDB entry)

8. Domain d6f4jb_: 6f4j B: [353674]
   Other proteins in same PDB: d6f4jc_, d6f4jd_
   automated match to d1a9nc_
   complexed with 15p, so4

Details for d6f4jb_

PDB Entry: 6f4j, 1.42 Å

PDB Description: crystal structure of drosophila melanogaster snf/u2a' complex

PDB Compounds: (B:) Probable U2 small nuclear ribonucleoprotein A'

SCOPe Domain Sequences for d6f4jb_:

Sequence; same for both SEQRES and ATOM records:

>d6f4jb_ c.10.2.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mvkltpelinqsmqyinpvrereldlrgykipqienlgatldqfdtidlsdndlrkldnl
phlprlktlllnnnrilrisegleeavpnlgsiiltgnnlqelsdleplvgftkletisl
linpvstkpnyreymaykfpqlrlldfrkikqkdrqaaqeffrtkqgkdvlkei

Timeline for d6f4jb_:

• d6f4jb_ first appeared in SCOPe 2.07