| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
| Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
| Protein automated matches [190787] (14 species) not a true protein |
| Species Drosophila melanogaster [TaxId:7227] [353673] (1 PDB entry) |
| Domain d6f4jb_: 6f4j B: [353674] Other proteins in same PDB: d6f4jc_, d6f4jd_ automated match to d1a9nc_ complexed with 15p, so4 |
PDB Entry: 6f4j (more details), 1.42 Å
SCOPe Domain Sequences for d6f4jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f4jb_ c.10.2.0 (B:) automated matches {Drosophila melanogaster [TaxId: 7227]}
mvkltpelinqsmqyinpvrereldlrgykipqienlgatldqfdtidlsdndlrkldnl
phlprlktlllnnnrilrisegleeavpnlgsiiltgnnlqelsdleplvgftkletisl
linpvstkpnyreymaykfpqlrlldfrkikqkdrqaaqeffrtkqgkdvlkei
Timeline for d6f4jb_: