Lineage for d6f4ja_ (6f4j A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459922Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2459991Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2460208Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2460209Protein automated matches [190787] (14 species)
    not a true protein
  7. 2460220Species Drosophila melanogaster [TaxId:7227] [353673] (1 PDB entry)
  8. 2460221Domain d6f4ja_: 6f4j A: [353711]
    Other proteins in same PDB: d6f4jc_, d6f4jd_
    automated match to d1a9nc_
    complexed with 15p, so4

Details for d6f4ja_

PDB Entry: 6f4j (more details), 1.42 Å

PDB Description: crystal structure of drosophila melanogaster snf/u2a' complex
PDB Compounds: (A:) Probable U2 small nuclear ribonucleoprotein A'

SCOPe Domain Sequences for d6f4ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f4ja_ c.10.2.0 (A:) automated matches {Drosophila melanogaster [TaxId: 7227]}
mvkltpelinqsmqyinpvrereldlrgykipqienlgatldqfdtidlsdndlrkldnl
phlprlktlllnnnrilrisegleeavpnlgsiiltgnnlqelsdleplvgftkletisl
linpvstkpnyreymaykfpqlrlldfrkikqkdrqaaqeffrtkqgkdvlkeis

SCOPe Domain Coordinates for d6f4ja_:

Click to download the PDB-style file with coordinates for d6f4ja_.
(The format of our PDB-style files is described here.)

Timeline for d6f4ja_: