Lineage for d1a9nc_ (1a9n C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851781Family c.10.2.4: U2A'-like [52068] (2 proteins)
    duplication: consists of 5-6 partly irregular repeats
    this is a repeat family; one repeat unit is 1a9n C:89-114 found in domain
  6. 2851782Protein Spliceosomal U2 small nuclear ribonucleoprotein A' / U2A' / Lea1 protein [52069] (2 species)
    3jb9 chain j is Lea1 from fission yeast; not included because sids are not case sensitive
  7. 2851783Species Human (Homo sapiens) [TaxId:9606] [52070] (1 PDB entry)
  8. 2851785Domain d1a9nc_: 1a9n C: [30876]
    Other proteins in same PDB: d1a9nb_, d1a9nd_
    protein/RNA complex

Details for d1a9nc_

PDB Entry: 1a9n (more details), 2.38 Å

PDB Description: crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna
PDB Compounds: (C:) u2a'

SCOPe Domain Sequences for d1a9nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9nc_ c.10.2.4 (C:) Spliceosomal U2 small nuclear ribonucleoprotein A' / U2A' / Lea1 protein {Human (Homo sapiens) [TaxId: 9606]}
vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp
llrrlktllvnnnricrigegldqalpdlteliltnnslvelgdldplaslksltylcil
rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfkgkrgaqlakdia

SCOPe Domain Coordinates for d1a9nc_:

Click to download the PDB-style file with coordinates for d1a9nc_.
(The format of our PDB-style files is described here.)

Timeline for d1a9nc_: