PDB entry 6f4j

View 6f4j on RCSB PDB site
Description: Crystal structure of Drosophila melanogaster SNF/U2A' complex
Class: splicing
Keywords: SNF, U2A', RRM, Splicing, Evolution
Deposited on 2017-11-29, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable U2 small nuclear ribonucleoprotein A'
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: U2A, CG1406
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9V4Q8 (0-End)
      • engineered mutation (18)
      • engineered mutation (67)
      • engineered mutation (118)
    Domains in SCOPe 2.07: d6f4ja_
  • Chain 'B':
    Compound: Probable U2 small nuclear ribonucleoprotein A'
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: U2A, CG1406
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9V4Q8 (0-End)
      • engineered mutation (18)
      • engineered mutation (67)
      • engineered mutation (118)
    Domains in SCOPe 2.07: d6f4jb_
  • Chain 'C':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: snf, D25, fs(1)1621, liz, CG4528
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f4jc_
  • Chain 'D':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: snf, D25, fs(1)1621, liz, CG4528
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f4jd_
  • Heterogens: 15P, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f4jA (A:)
    mvkltpelinqsmqyinpvrereldlrgykipqienlgatldqfdtidlsdndlrkldnl
    phlprlktlllnnnrilrisegleeavpnlgsiiltgnnlqelsdleplvgftkletisl
    linpvstkpnyreymaykfpqlrlldfrkikqkdrqaaqeffrtkqgkdvlkeisr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f4jA (A:)
    mvkltpelinqsmqyinpvrereldlrgykipqienlgatldqfdtidlsdndlrkldnl
    phlprlktlllnnnrilrisegleeavpnlgsiiltgnnlqelsdleplvgftkletisl
    linpvstkpnyreymaykfpqlrlldfrkikqkdrqaaqeffrtkqgkdvlkeis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f4jB (B:)
    mvkltpelinqsmqyinpvrereldlrgykipqienlgatldqfdtidlsdndlrkldnl
    phlprlktlllnnnrilrisegleeavpnlgsiiltgnnlqelsdleplvgftkletisl
    linpvstkpnyreymaykfpqlrlldfrkikqkdrqaaqeffrtkqgkdvlkeisr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f4jB (B:)
    mvkltpelinqsmqyinpvrereldlrgykipqienlgatldqfdtidlsdndlrkldnl
    phlprlktlllnnnrilrisegleeavpnlgsiiltgnnlqelsdleplvgftkletisl
    linpvstkpnyreymaykfpqlrlldfrkikqkdrqaaqeffrtkqgkdvlkei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6f4jC (C:)
    gamemlpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifke
    igsasnalrtmqgfpfydkpmqiaysksdsdivakikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f4jC (C:)
    lpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeigsas
    nalrtmqgfpfydkpmqiaysksdsdivakik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6f4jD (D:)
    gamemlpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifke
    igsasnalrtmqgfpfydkpmqiaysksdsdivakikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f4jD (D:)
    mlpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeigsa
    snalrtmqgfpfydkpmqiaysksdsdivaki