Lineage for d6f4jc_ (6f4j C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952339Protein automated matches [190332] (5 species)
    not a true protein
  7. 2952340Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311207] (4 PDB entries)
  8. 2952341Domain d6f4jc_: 6f4j C: [353703]
    Other proteins in same PDB: d6f4ja_, d6f4jb_
    automated match to d2fjja_
    complexed with 15p, so4

Details for d6f4jc_

PDB Entry: 6f4j (more details), 1.42 Å

PDB Description: crystal structure of drosophila melanogaster snf/u2a' complex
PDB Compounds: (C:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d6f4jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f4jc_ d.58.7.1 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeigsas
nalrtmqgfpfydkpmqiaysksdsdivakik

SCOPe Domain Coordinates for d6f4jc_:

Click to download the PDB-style file with coordinates for d6f4jc_.
(The format of our PDB-style files is described here.)

Timeline for d6f4jc_: