Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein automated matches [190332] (5 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311207] (4 PDB entries) |
Domain d6f4jc_: 6f4j C: [353703] Other proteins in same PDB: d6f4ja_, d6f4jb_ automated match to d2fjja_ complexed with 15p, so4 |
PDB Entry: 6f4j (more details), 1.42 Å
SCOPe Domain Sequences for d6f4jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f4jc_ d.58.7.1 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} lpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeigsas nalrtmqgfpfydkpmqiaysksdsdivakik
Timeline for d6f4jc_: