SCOPe 2.08: Domain d5o4gc2: 5o4g C:166-322

Lineage for d5o4gc2 (5o4g C:166-322)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.0: automated matches [232406] (1 protein)
   not a true family

6. Protein automated matches [232407] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries)

8. Domain d5o4gc2: 5o4g C:166-322 [352243]
   Other proteins in same PDB: d5o4ga1, d5o4ga2, d5o4gc1, d5o4gc3
   automated match to d1n8zc3
   complexed with nag

Details for d5o4gc2

PDB Entry: 5o4g, 3 Å

PDB Description: her2 in complex with fab mf3958

PDB Compounds: (C:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d5o4gc2:

Sequence; same for both SEQRES and ATOM records:

>d5o4gc2 g.3.9.0 (C:166-322) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp
khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd
vgsctlvcplhnqevtaedgtqrcekcskpcarvcyg

Timeline for d5o4gc2:

• d5o4gc2 first appeared in SCOPe 2.07