Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) |
Family g.3.9.0: automated matches [232406] (1 protein) not a true family |
Protein automated matches [232407] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries) |
Domain d5o4gc2: 5o4g C:166-322 [352243] Other proteins in same PDB: d5o4ga1, d5o4ga2, d5o4gc1, d5o4gc3 automated match to d1n8zc3 complexed with bma, man, nag |
PDB Entry: 5o4g (more details), 3 Å
SCOPe Domain Sequences for d5o4gc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o4gc2 g.3.9.0 (C:166-322) automated matches {Human (Homo sapiens) [TaxId: 9606]} rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd vgsctlvcplhnqevtaedgtqrcekcskpcarvcyg
Timeline for d5o4gc2: