![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (29 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
![]() | Domain d5o4ga1: 5o4g A:1-106 [352189] Other proteins in same PDB: d5o4ga2, d5o4gc1, d5o4gc2, d5o4gc3 automated match to d1dn0a1 complexed with bma, man, nag |
PDB Entry: 5o4g (more details), 3 Å
SCOPe Domain Sequences for d5o4ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o4ga1 b.1.1.0 (A:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps rfsgsgsgtdftltisslqpedfatyycqqsystpptfgqgtkvei
Timeline for d5o4ga1: