SCOPe 2.07: Domain d5o4gc1: 5o4g C:1-165

Lineage for d5o4gc1 (5o4g C:1-165)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries)

8. Domain d5o4gc1: 5o4g C:1-165 [352242]
   Other proteins in same PDB: d5o4ga1, d5o4ga2, d5o4gc2
   automated match to d1n8zc1
   complexed with bma, man, nag

Details for d5o4gc1

PDB Entry: 5o4g, 3 Å

PDB Description: her2 in complex with fab mf3958

PDB Compounds: (C:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d5o4gc1:

Sequence, based on SEQRES records:

>d5o4gc1 c.10.2.0 (C:1-165) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqg
yvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelql
rslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtn

Sequence, based on observed residues (ATOM records):

>d5o4gc1 c.10.2.0 (C:1-165) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqg
yvliahnqvrqvplqrlrivrgtqlfednyalavldngdpgglrelqlrslteilkggvl
iqrnpqlcyqdtilwkdifhknnqlaltlidtn

Timeline for d5o4gc1:

• d5o4gc1 is new in SCOPe 2.07-stable
  
• d5o4gc1 appears in the current release, SCOPe 2.08