Lineage for d1gpl_2 (1gpl 1-336)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) 
Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (1 protein) Protein Pancreatic lipase, N-terminal domain [53578] (6 species) 
Species Guinea pig (Cavia porcellus) [TaxId:10141] [53582] (1 PDB entry) 
Domain d1gpl_2: 1gpl 1-336 [34793]
Other proteins in same PDB: d1gpl_1
Details for d1gpl_2
PDB Entry: 1gpl (more details), 2.1 Å
PDB Description: rp2 lipase
SCOP Domain Sequences for d1gpl_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpl_2 c.69.1.19 (1-336) Pancreatic lipase, N-terminal domain {Guinea pig (Cavia porcellus)}
aevcyshlgcfsdekpwagtsqrpikslpsdpkkintrfllytnenqnsyqlitatdiat
ikasnfnlnrktrfiihgftdsgenswlsdmcknmfqvekvncicvdwkggskaqysqas
qnirvvgaevaylvqvlstslnyapenvhiighslgahtageagkrlnglvgritgldpa
epyfqdtpeevrldpsdakfvdvihtdispilpslgfgmsqkvghmdffpnggkdmpgck
tgiscnhhrsieyyhssilnpegflgypcasydefqesgcfpcpakgcpkmghfadqypg
ktnaveqtfflntgasdnft
SCOP Domain Coordinates for d1gpl_2:
Click to download the PDB-style file with coordinates for d1gpl_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gpl_2:
- d1gpl_2 appears in SCOP 1.57
- d1gpl_2 appears in the current release, SCOPe 2.08, called d1gpla2
View in 3D
