Lineage for d1gpl_1 (1gpl 337-449)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.12: Lipase/lipooxygenase domain [49722] (1 superfamily) Superfamily b.12.1: Lipase/lipooxygenase domain [49723] (3 families) 
Family b.12.1.2: Colipase-binding domain [49730] (1 protein) Protein Pancreatic lipase, C-terminal domain [49731] (6 species) 
Species Guinea pig (Cavia porcellus) [TaxId:10141] [49735] (1 PDB entry) 
Domain d1gpl_1: 1gpl 337-449 [23645]
Other proteins in same PDB: d1gpl_2
Details for d1gpl_1
PDB Entry: 1gpl (more details), 2.1 Å
PDB Description: rp2 lipase
SCOP Domain Sequences for d1gpl_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpl_1 b.12.1.2 (337-449) Pancreatic lipase, C-terminal domain {Guinea pig (Cavia porcellus)}
rwrykvsvtlsgkkvtghilvslfgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlq
mvkfiwynnvinptlprvgaskiivetnvgkqfnfcspetvreevlltltpc
SCOP Domain Coordinates for d1gpl_1:
Click to download the PDB-style file with coordinates for d1gpl_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gpl_1:
- d1gpl_1 appears in SCOP 1.57
- d1gpl_1 appears in the current release, SCOPe 2.08, called d1gpla1
View in 3D
