Lineage for d1gpl_2 (1gpl 1-336)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73651Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 73652Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 73967Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (1 protein)
  6. 73968Protein Pancreatic lipase, N-terminal domain [53578] (6 species)
  7. 73971Species Guinea pig (Cavia porcellus) [TaxId:10141] [53582] (1 PDB entry)
  8. 73972Domain d1gpl_2: 1gpl 1-336 [34793]
    Other proteins in same PDB: d1gpl_1

Details for d1gpl_2

PDB Entry: 1gpl (more details), 2.1 Å

PDB Description: rp2 lipase

SCOP Domain Sequences for d1gpl_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpl_2 c.69.1.19 (1-336) Pancreatic lipase, N-terminal domain {Guinea pig (Cavia porcellus)}
aevcyshlgcfsdekpwagtsqrpikslpsdpkkintrfllytnenqnsyqlitatdiat
ikasnfnlnrktrfiihgftdsgenswlsdmcknmfqvekvncicvdwkggskaqysqas
qnirvvgaevaylvqvlstslnyapenvhiighslgahtageagkrlnglvgritgldpa
epyfqdtpeevrldpsdakfvdvihtdispilpslgfgmsqkvghmdffpnggkdmpgck
tgiscnhhrsieyyhssilnpegflgypcasydefqesgcfpcpakgcpkmghfadqypg
ktnaveqtfflntgasdnft

SCOP Domain Coordinates for d1gpl_2:

Click to download the PDB-style file with coordinates for d1gpl_2.
(The format of our PDB-style files is described here.)

Timeline for d1gpl_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gpl_1