Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) automatically mapped to Pfam PF02939 |
Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins) |
Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
Species Cow (Bos taurus) [TaxId:9913] [81503] (21 PDB entries) Uniprot P13271 #SP ! Uniprot P13271 |
Domain d5okdg_: 5okd G: [347344] Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde1, d5okde2, d5okdh_, d5okdi_, d5okdj_ automated match to d1be3g_ complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4 |
PDB Entry: 5okd (more details), 3.1 Å
SCOPe Domain Sequences for d5okdg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5okdg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} rqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvytw gtqefekskrknpa
Timeline for d5okdg_: