Lineage for d5okdj_ (5okd J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631382Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 2631383Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 2631420Protein automated matches [190326] (4 species)
    not a true protein
  7. 2631433Species Bos taurus [TaxId:9913] [347169] (1 PDB entry)
  8. 2631434Domain d5okdj_: 5okd J: [347170]
    Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde1, d5okde2, d5okdg_, d5okdh_, d5okdi_
    automated match to d2a06w_
    complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okdj_

PDB Entry: 5okd (more details), 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.
PDB Compounds: (J:) Cytochrome b-c1 complex subunit 9

SCOPe Domain Sequences for d5okdj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5okdj_ f.23.14.1 (J:) automated matches {Bos taurus [TaxId: 9913]}
aptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye

SCOPe Domain Coordinates for d5okdj_:

Click to download the PDB-style file with coordinates for d5okdj_.
(The format of our PDB-style files is described here.)

Timeline for d5okdj_: