Lineage for d5okdh_ (5okd H:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633065Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2633066Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 2633067Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 2633101Protein automated matches [190042] (4 species)
    not a true protein
  7. 2633119Species Cow (Bos taurus) [TaxId:9913] [186764] (7 PDB entries)
  8. 2633127Domain d5okdh_: 5okd H: [347166]
    Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde1, d5okde2, d5okdg_, d5okdi_, d5okdj_
    automated match to d1l0lh_
    complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okdh_

PDB Entry: 5okd (more details), 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.
PDB Compounds: (H:) cytochrome b-c1 complex subunit 6, mitochondrial

SCOPe Domain Sequences for d5okdh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5okdh_ f.28.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk
lfnsl

SCOPe Domain Coordinates for d5okdh_:

Click to download the PDB-style file with coordinates for d5okdh_.
(The format of our PDB-style files is described here.)

Timeline for d5okdh_: