![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) ![]() location - intermembrane side of the bc1 complex automatically mapped to Pfam PF02320 |
![]() | Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
![]() | Protein automated matches [190042] (4 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [186764] (7 PDB entries) |
![]() | Domain d5okdh_: 5okd H: [347166] Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde1, d5okde2, d5okdg_, d5okdi_, d5okdj_ automated match to d1l0lh_ complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4 |
PDB Entry: 5okd (more details), 3.1 Å
SCOPe Domain Sequences for d5okdh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5okdh_ f.28.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]} lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk lfnsl
Timeline for d5okdh_: