Lineage for d5okdi_ (5okd I:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611009Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 2611010Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) (S)
    not a true superfamily
  5. 2611025Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (2 proteins)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 2611026Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 2611027Species Cow (Bos taurus) [TaxId:9913] [90079] (15 PDB entries)
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
    Uniprot P13272 1-57 ! Uniprot P13272
  8. 2611045Domain d5okdi_: 5okd I: [347301]
    Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde1, d5okde2, d5okdg_, d5okdh_, d5okdj_
    automated match to d2a06i_
    complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okdi_

PDB Entry: 5okd (more details), 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.
PDB Compounds: (I:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d5okdi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5okdi_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
avpatsespvldlkrsvlcreslrgqaagrplvasvslnvpasvry

SCOPe Domain Coordinates for d5okdi_:

Click to download the PDB-style file with coordinates for d5okdi_.
(The format of our PDB-style files is described here.)

Timeline for d5okdi_: