SCOPe 2.07: Domain d5okdc1: 5okd C:2-260

Lineage for d5okdc1 (5okd C:2-260)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein automated matches [196844] (6 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [254895] (2 PDB entries)

8. Domain d5okdc1: 5okd C:2-260 [347223]
   Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc2, d5okdd1, d5okdd2, d5okde1, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_
   automated match to d1be3c3
   complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okdc1

PDB Entry: 5okd, 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d5okdc1:

Sequence; same for both SEQRES and ATOM records:

>d5okdc1 f.21.1.2 (C:2-260) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
lvlfapdllgdpdnytpan

Timeline for d5okdc1:

• d5okdc1 is new in SCOPe 2.07-stable
  
• d5okdc1 appears in the current release, SCOPe 2.08