SCOPe 2.07: Domain d5okda1: 5okd A:2-233

Lineage for d5okda1 (5okd A:2-233)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein automated matches [254430] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [254891] (2 PDB entries)

8. Domain d5okda1: 5okd A:2-233 [347209]
   Other proteins in same PDB: d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde1, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_
   automated match to d2a06a1
   complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okda1

PDB Entry: 5okd, 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.

PDB Compounds: (A:) Cytochrome b-c1 complex subunit 1, mitochondrial

SCOPe Domain Sequences for d5okda1:

Sequence; same for both SEQRES and ATOM records:

>d5okda1 d.185.1.1 (A:2-233) automated matches {Cow (Bos taurus) [TaxId: 9913]}
atyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfveh
lafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqncs
ledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsrad
lteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydeetvptlsp

Timeline for d5okda1:

• d5okda1 is new in SCOPe 2.07-stable
  
• d5okda1 appears in the current release, SCOPe 2.08