Lineage for d5gmkf_ (5gmk F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012252Fold d.395: Pre-mRNA splicing factor Cwc16-like [345892] (1 superfamily)
    Extended loop and helix, followed by a 5-stranded beta sheet (order 12345) with two zinc-binding CxxC motifs in loops between strands 1,2 and 3,4
  4. 3012253Superfamily d.395.1: Pre-mRNA splicing factor Cwc16-like [345925] (1 family) (S)
    N-terminal part of Pfam PF04502
  5. 3012254Family d.395.1.1: Pre-mRNA splicing factor Cwc16-like [345980] (1 protein)
  6. 3012255Protein Pre-mRNA splicing factor Cwc16 / Yju2 [346114] (1 species)
  7. 3012256Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292] [346404] (1 PDB entry)
  8. 3012257Domain d5gmkf_: 5gmk F: [345641]
    Other proteins in same PDB: d5gmka_, d5gmkb_, d5gmkd_, d5gmkg_, d5gmkh_, d5gmki_, d5gmkn1, d5gmkn2, d5gmkv_
    protein/RNA complex; complexed with gtp, mg, zn

Details for d5gmkf_

PDB Entry: 5gmk (more details), 3.4 Å

PDB Description: cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
PDB Compounds: (F:) Protein CWC16

SCOPe Domain Sequences for d5gmkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gmkf_ d.395.1.1 (F:) Pre-mRNA splicing factor Cwc16 / Yju2 {Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId: 559292]}
serkainkyyppdynpleaeklsrkmakklktmnkshasirlmtpfsmrclecneyipks
rkfngkkellkekyldsikiyrltiscprcansiafrtdpgnsdyvmevggvrny

SCOPe Domain Coordinates for d5gmkf_:

Click to download the PDB-style file with coordinates for d5gmkf_.
(The format of our PDB-style files is described here.)

Timeline for d5gmkf_: