Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein Spliceosomal U2 small nuclear ribonucleoprotein B' / U2B' / Msl1 protein [54934] (2 species) 3jb9 chain k is Msl1 from fission yeast; not included because sids are not case sensitive |
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292] [346359] (1 PDB entry) |
Domain d5gmka_: 5gmk a: [345638] Other proteins in same PDB: d5gmkb_, d5gmkd_, d5gmkf_, d5gmkg_, d5gmkh_, d5gmki_, d5gmkn1, d5gmkn2, d5gmkv_ protein/RNA complex; complexed with gtp, mg, zn |
PDB Entry: 5gmk (more details), 3.4 Å
SCOPe Domain Sequences for d5gmka_:
Sequence, based on SEQRES records: (download)
>d5gmka_ d.58.7.1 (a:) Spliceosomal U2 small nuclear ribonucleoprotein B' / U2B' / Msl1 protein {Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId: 559292]} tlyvsqlnekinmqrlrvnlfllfatfgevlkvsmnfkkqrgqafitmrtidqaslaqis lngerffgkplkvefsksetktl
>d5gmka_ d.58.7.1 (a:) Spliceosomal U2 small nuclear ribonucleoprotein B' / U2B' / Msl1 protein {Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId: 559292]} tlyvsqlnekinmqrlrvnlfllfatfgevvsmnfkkqrgqafitmrtidqaslaqisln gerffgkplkvefsksetktl
Timeline for d5gmka_: