Lineage for d5gmka_ (5gmk a:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952180Protein Spliceosomal U2 small nuclear ribonucleoprotein B' / U2B' / Msl1 protein [54934] (2 species)
    3jb9 chain k is Msl1 from fission yeast; not included because sids are not case sensitive
  7. 2952184Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292] [346359] (1 PDB entry)
  8. 2952185Domain d5gmka_: 5gmk a: [345638]
    Other proteins in same PDB: d5gmkb_, d5gmkd_, d5gmkf_, d5gmkg_, d5gmkh_, d5gmki_, d5gmkn1, d5gmkn2, d5gmkv_
    protein/RNA complex; complexed with gtp, mg, zn

Details for d5gmka_

PDB Entry: 5gmk (more details), 3.4 Å

PDB Description: cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
PDB Compounds: (a:) U2 small nuclear ribonucleoprotein B''

SCOPe Domain Sequences for d5gmka_:

Sequence, based on SEQRES records: (download)

>d5gmka_ d.58.7.1 (a:) Spliceosomal U2 small nuclear ribonucleoprotein B' / U2B' / Msl1 protein {Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId: 559292]}
tlyvsqlnekinmqrlrvnlfllfatfgevlkvsmnfkkqrgqafitmrtidqaslaqis
lngerffgkplkvefsksetktl

Sequence, based on observed residues (ATOM records): (download)

>d5gmka_ d.58.7.1 (a:) Spliceosomal U2 small nuclear ribonucleoprotein B' / U2B' / Msl1 protein {Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId: 559292]}
tlyvsqlnekinmqrlrvnlfllfatfgevvsmnfkkqrgqafitmrtidqaslaqisln
gerffgkplkvefsksetktl

SCOPe Domain Coordinates for d5gmka_:

Click to download the PDB-style file with coordinates for d5gmka_.
(The format of our PDB-style files is described here.)

Timeline for d5gmka_: