Lineage for d5gmkh_ (5gmk H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2302754Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303557Superfamily a.2.15: ISY1 domain-like [140102] (1 family) (S)
    automatically mapped to Pfam PF06246
  5. 2303558Family a.2.15.1: ISY1 N-terminal domain-like [140103] (2 protein domains)
    N-terminal region of Pfam PF06246
  6. 2303559Protein Pre-mRNA splicing factor Isl1 [346011] (1 species)
  7. 2303560Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292] [346155] (1 PDB entry)
  8. 2303561Domain d5gmkh_: 5gmk H: [345643]
    Other proteins in same PDB: d5gmka_, d5gmkb_, d5gmkd_, d5gmkf_, d5gmkg_, d5gmki_, d5gmkn1, d5gmkn2, d5gmkv_
    protein/RNA complex; complexed with gtp, mg, zn

Details for d5gmkh_

PDB Entry: 5gmk (more details), 3.4 Å

PDB Description: cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
PDB Compounds: (H:) Pre-mRNA-splicing factor ISY1

SCOPe Domain Sequences for d5gmkh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gmkh_ a.2.15.1 (H:) Pre-mRNA splicing factor Isl1 {Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId: 559292]}
srnvdkansvlvrfqeqqaesaggykdysryqrprnvskvksikeanewkrqvskeikqk
striydpslnemqiaelndelnnlfkewkrwqwhi

SCOPe Domain Coordinates for d5gmkh_:

Click to download the PDB-style file with coordinates for d5gmkh_.
(The format of our PDB-style files is described here.)

Timeline for d5gmkh_:

  • d5gmkh_ is new in SCOPe 2.07-stable