SCOPe 2.08: Domain d5gmkb_: 5gmk b:

Lineage for d5gmkb_ (5gmk b:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.4: U2A'-like [52068] (2 proteins)
   duplication: consists of 5-6 partly irregular repeats
   this is a repeat family; one repeat unit is 1a9n C:89-114 found in domain

6. Protein Spliceosomal U2 small nuclear ribonucleoprotein A' / U2A' / Lea1 protein [52069] (2 species)
   3jb9 chain j is Lea1 from fission yeast; not included because sids are not case sensitive

7. Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292] [346281] (1 PDB entry)

8. Domain d5gmkb_: 5gmk b: [345639]
   Other proteins in same PDB: d5gmka_, d5gmkd_, d5gmkf_, d5gmkg_, d5gmkh_, d5gmki_, d5gmkn1, d5gmkn2, d5gmkv_
   protein/RNA complex; complexed with gtp, mg, zn

Details for d5gmkb_

PDB Entry: 5gmk, 3.4 Å

PDB Description: cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution

PDB Compounds: (b:) U2 small nuclear ribonucleoprotein A'

SCOPe Domain Sequences for d5gmkb_:

Sequence, based on SEQRES records:

>d5gmkb_ c.10.2.4 (b:) Spliceosomal U2 small nuclear ribonucleoprotein A' / U2A' / Lea1 protein {Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId: 559292]}
mkftpsividapqyyvdhfngkynvdkcvilrdlqletdsesmpsslkhltkpthildlt
nndlimipdlsrrddihtlllgrnnivevdgrllpmnvqnltlsnnsirrfedlqrlrra
prtlknltlignqvchlanyrehvlrlvphletldfqnvtae

Sequence, based on observed residues (ATOM records):

>d5gmkb_ c.10.2.4 (b:) Spliceosomal U2 small nuclear ribonucleoprotein A' / U2A' / Lea1 protein {Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId: 559292]}
mkftpsividapqyyvddlqletesmpsslkhltkpthildltnndlimipdlsrrddih
tlllgrnnivevdvqnltlsnnsirrfedlqrlrralknltlignqvchlanyrehvlrl
vphletldfqnvtae

Timeline for d5gmkb_:

• d5gmkb_ first appeared in SCOPe 2.07