Lineage for d5gmkb_ (5gmk b:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435068Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2435137Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2435208Family c.10.2.4: U2A'-like [52068] (1 protein)
    duplication: consists of 5-6 partly irregular repeats
  6. 2435209Protein Spliceosomal U2 small nuclear ribonucleoprotein A' / U2A' / Lea1 protein [52069] (2 species)
    3jb9 chain j is Lea1 from fission yeast; not included because sids are not case sensitive
  7. 2435213Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292] [346281] (1 PDB entry)
  8. 2435214Domain d5gmkb_: 5gmk b: [345639]
    Other proteins in same PDB: d5gmka_, d5gmkd_, d5gmkf_, d5gmkg_, d5gmkh_, d5gmki_, d5gmkn1, d5gmkn2, d5gmkv_
    protein/RNA complex; complexed with gtp, mg, zn

Details for d5gmkb_

PDB Entry: 5gmk (more details), 3.4 Å

PDB Description: cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
PDB Compounds: (b:) U2 small nuclear ribonucleoprotein A'

SCOPe Domain Sequences for d5gmkb_:

Sequence, based on SEQRES records: (download)

>d5gmkb_ c.10.2.4 (b:) Spliceosomal U2 small nuclear ribonucleoprotein A' / U2A' / Lea1 protein {Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId: 559292]}
mkftpsividapqyyvdhfngkynvdkcvilrdlqletdsesmpsslkhltkpthildlt
nndlimipdlsrrddihtlllgrnnivevdgrllpmnvqnltlsnnsirrfedlqrlrra
prtlknltlignqvchlanyrehvlrlvphletldfqnvtae

Sequence, based on observed residues (ATOM records): (download)

>d5gmkb_ c.10.2.4 (b:) Spliceosomal U2 small nuclear ribonucleoprotein A' / U2A' / Lea1 protein {Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId: 559292]}
mkftpsividapqyyvddlqletesmpsslkhltkpthildltnndlimipdlsrrddih
tlllgrnnivevdvqnltlsnnsirrfedlqrlrralknltlignqvchlanyrehvlrl
vphletldfqnvtae

SCOPe Domain Coordinates for d5gmkb_:

Click to download the PDB-style file with coordinates for d5gmkb_.
(The format of our PDB-style files is described here.)

Timeline for d5gmkb_:

  • d5gmkb_ is new in SCOPe 2.07-stable