SCOPe 2.08: Domain d5g1zb2: 5g1z B:211-410

Lineage for d5g1zb2 (5g1z B:211-410)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
   duplication: consists of two NAT-like domains swapped with the C-terminal strands

6. Protein N-myristoyl transferase, NMT [55749] (4 species)

7. Species Plasmodium vivax [TaxId:5855] [346374] (2 PDB entries)

8. Domain d5g1zb2: 5g1z B:211-410 [344222]
   Other proteins in same PDB: d5g1za1, d5g1zb1, d5g1zc1
   complexed with cl, dms, mg, nhw, so4, u53

Details for d5g1zb2

PDB Entry: 5g1z, 1.5 Å

PDB Description: plasmodium vivax n-myristoyltransferase in complex with a quinoline inhibitor (compound 1)

PDB Compounds: (B:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d5g1zb2:

Sequence; same for both SEQRES and ATOM records:

>d5g1zb2 d.108.1.2 (B:211-410) N-myristoyl transferase, NMT {Plasmodium vivax [TaxId: 5855]}
yyhrsinvkklieigfsslnsrltmsraiklyrvedtlniknmrlmkkkdvegvhkllgs
yleqfnlyavftkeeiahwflpienviytyvneengkikdmisfyslpsqilgndkystl
naaysfynvtttatfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegdgslky
ylynwkcasfapahvgivll

Timeline for d5g1zb2:

• d5g1zb2 first appeared in SCOPe 2.07