Lineage for d5g1zb2 (5g1z B:211-410)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575431Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 2575432Protein N-myristoyl transferase, NMT [55749] (4 species)
  7. 2575451Species Plasmodium vivax [TaxId:5855] [346374] (2 PDB entries)
  8. 2575453Domain d5g1zb2: 5g1z B:211-410 [344222]
    Other proteins in same PDB: d5g1za1, d5g1zb1, d5g1zc1
    complexed with cl, dms, mg, nhw, so4, u53

Details for d5g1zb2

PDB Entry: 5g1z (more details), 1.5 Å

PDB Description: plasmodium vivax n-myristoyltransferase in complex with a quinoline inhibitor (compound 1)
PDB Compounds: (B:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d5g1zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g1zb2 d.108.1.2 (B:211-410) N-myristoyl transferase, NMT {Plasmodium vivax [TaxId: 5855]}
yyhrsinvkklieigfsslnsrltmsraiklyrvedtlniknmrlmkkkdvegvhkllgs
yleqfnlyavftkeeiahwflpienviytyvneengkikdmisfyslpsqilgndkystl
naaysfynvtttatfkqlmqdaillakrnnfdvfnalevmqnksvfedlkfgegdgslky
ylynwkcasfapahvgivll

SCOPe Domain Coordinates for d5g1zb2:

Click to download the PDB-style file with coordinates for d5g1zb2.
(The format of our PDB-style files is described here.)

Timeline for d5g1zb2: