Lineage for d5g1zb1 (5g1z B:26-210)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969271Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries)
  8. 2969297Domain d5g1zb1: 5g1z B:26-210 [329767]
    Other proteins in same PDB: d5g1za2, d5g1zb2, d5g1zc2
    automated match to d1iica1
    complexed with cl, dms, mg, nhw, so4, u53

Details for d5g1zb1

PDB Entry: 5g1z (more details), 1.5 Å

PDB Description: plasmodium vivax n-myristoyltransferase in complex with a quinoline inhibitor (compound 1)
PDB Compounds: (B:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d5g1zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g1zb1 d.108.1.0 (B:26-210) automated matches {Plasmodium vivax [TaxId: 5855]}
idykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrs
eiytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaip
tdicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkp
vsdar

SCOPe Domain Coordinates for d5g1zb1:

Click to download the PDB-style file with coordinates for d5g1zb1.
(The format of our PDB-style files is described here.)

Timeline for d5g1zb1: