| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (49 species) not a true protein |
| Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries) |
| Domain d5g1zb1: 5g1z B:26-210 [329767] Other proteins in same PDB: d5g1za2, d5g1zb2, d5g1zc2 automated match to d1iica1 complexed with cl, dms, mg, nhw, so4, u53 |
PDB Entry: 5g1z (more details), 1.5 Å
SCOPe Domain Sequences for d5g1zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g1zb1 d.108.1.0 (B:26-210) automated matches {Plasmodium vivax [TaxId: 5855]}
idykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrs
eiytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaip
tdicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkp
vsdar
Timeline for d5g1zb1:
View in 3DDomains from other chains: (mouse over for more information) d5g1za1, d5g1za2, d5g1zc1, d5g1zc2 |