SCOPe 2.08: Domain d5g1za1: 5g1z A:26-210

Lineage for d5g1za1 (5g1z A:26-210)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:5855] [234134] (20 PDB entries)

8. Domain d5g1za1: 5g1z A:26-210 [329794]
   Other proteins in same PDB: d5g1za2, d5g1zb2, d5g1zc2
   automated match to d1iica1
   complexed with cl, dms, mg, nhw, so4, u53

Details for d5g1za1

PDB Entry: 5g1z, 1.5 Å

PDB Description: plasmodium vivax n-myristoyltransferase in complex with a quinoline inhibitor (compound 1)

PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d5g1za1:

Sequence; same for both SEQRES and ATOM records:

>d5g1za1 d.108.1.0 (A:26-210) automated matches {Plasmodium vivax [TaxId: 5855]}
idykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrs
eiytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaip
tdicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkp
vsdar

Timeline for d5g1za1:

• d5g1za1 first appeared in SCOPe 2.06
  
• d5g1za1 appears in SCOPe 2.07