Lineage for d5g1za1 (5g1z A:26-210)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2209919Species Plasmodium vivax [TaxId:5855] [234134] (12 PDB entries)
  8. 2209935Domain d5g1za1: 5g1z A:26-210 [329794]
    automated match to d1iica1
    complexed with cl, dms, mg, nhw, so4, u53

Details for d5g1za1

PDB Entry: 5g1z (more details), 1.5 Å

PDB Description: plasmodium vivax n-myristoyltransferase in complex with a quinoline inhibitor (compound 1)
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d5g1za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g1za1 d.108.1.0 (A:26-210) automated matches {Plasmodium vivax [TaxId: 5855]}
idykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrs
eiytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaip
tdicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkp
vsdar

SCOPe Domain Coordinates for d5g1za1:

Click to download the PDB-style file with coordinates for d5g1za1.
(The format of our PDB-style files is described here.)

Timeline for d5g1za1: