Lineage for d3jwne_ (3jwn E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2363595Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2363797Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2364168Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2364169Protein automated matches [190503] (10 species)
    not a true protein
  7. 2364195Species Escherichia coli [TaxId:83333] [346217] (3 PDB entries)
  8. 2364196Domain d3jwne_: 3jwn E: [343811]
    Other proteins in same PDB: d3jwnc1, d3jwnc2, d3jwnh1, d3jwnh2, d3jwni1, d3jwni2, d3jwnn1, d3jwnn2
    automated match to d5lp9a_
    complexed with gol

Details for d3jwne_

PDB Entry: 3jwn (more details), 2.69 Å

PDB Description: Complex of FimC, FimF, FimG and FimH
PDB Compounds: (E:) Protein fimF

SCOPe Domain Sequences for d3jwne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwne_ b.2.3.0 (E:) automated matches {Escherichia coli [TaxId: 83333]}
adstitirgyvrdngcsvaaestnftvdlmenaakqfnnigattpvvpfrillspcgnav
savkvgftgvadshnanllalentvsaaaglgiqllneqqnqiplnapssalswttltpg
kpntlnfyarlmatqvpvtaghinatatftleyq

SCOPe Domain Coordinates for d3jwne_:

Click to download the PDB-style file with coordinates for d3jwne_.
(The format of our PDB-style files is described here.)

Timeline for d3jwne_:

  • d3jwne_ is new in SCOPe 2.07-stable