SCOPe 2.08: Domain d3jwne_: 3jwn E:

Lineage for d3jwne_ (3jwn E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.0: automated matches [191391] (1 protein)
   not a true family

6. Protein automated matches [190503] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [346217] (8 PDB entries)

8. Domain d3jwne_: 3jwn E: [343811]
   Other proteins in same PDB: d3jwnc1, d3jwnc2, d3jwnh1, d3jwnh2, d3jwni1, d3jwni2, d3jwnn1, d3jwnn2
   automated match to d5lp9a_
   complexed with gol

Details for d3jwne_

PDB Entry: 3jwn, 2.69 Å

PDB Description: Complex of FimC, FimF, FimG and FimH

PDB Compounds: (E:) Protein fimF

SCOPe Domain Sequences for d3jwne_:

Sequence; same for both SEQRES and ATOM records:

>d3jwne_ b.2.3.0 (E:) automated matches {Escherichia coli [TaxId: 83333]}
adstitirgyvrdngcsvaaestnftvdlmenaakqfnnigattpvvpfrillspcgnav
savkvgftgvadshnanllalentvsaaaglgiqllneqqnqiplnapssalswttltpg
kpntlnfyarlmatqvpvtaghinatatftleyq

Timeline for d3jwne_:

• d3jwne_ first appeared in SCOPe 2.07