Lineage for d3jwnn1 (3jwn N:1-158)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767660Protein automated matches [190569] (9 species)
    not a true protein
  7. 2767668Species Escherichia coli [TaxId:488477] [232652] (2 PDB entries)
  8. 2767675Domain d3jwnn1: 3jwn N:1-158 [232655]
    Other proteins in same PDB: d3jwnc1, d3jwnc2, d3jwne_, d3jwnf_, d3jwni1, d3jwni2, d3jwnk_, d3jwnl_
    automated match to d4av5a_
    complexed with gol

Details for d3jwnn1

PDB Entry: 3jwn (more details), 2.69 Å

PDB Description: Complex of FimC, FimF, FimG and FimH
PDB Compounds: (N:) FimH PROTEIN

SCOPe Domain Sequences for d3jwnn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwnn1 b.2.3.2 (N:1-158) automated matches {Escherichia coli [TaxId: 488477]}
facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d3jwnn1:

Click to download the PDB-style file with coordinates for d3jwnn1.
(The format of our PDB-style files is described here.)

Timeline for d3jwnn1: