Lineage for d3jwnc2 (3jwn C:122-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773151Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2773152Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2773170Protein FimC [49588] (1 species)
  7. 2773171Species Escherichia coli [TaxId:562] [49589] (11 PDB entries)
  8. 2773174Domain d3jwnc2: 3jwn C:122-205 [212128]
    Other proteins in same PDB: d3jwnc1, d3jwne_, d3jwnf_, d3jwnh1, d3jwnh2, d3jwni1, d3jwnk_, d3jwnl_, d3jwnn1, d3jwnn2
    automated match to d1bf8a2
    complexed with gol

Details for d3jwnc2

PDB Entry: 3jwn (more details), 2.69 Å

PDB Description: Complex of FimC, FimF, FimG and FimH
PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d3jwnc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwnc2 b.7.2.1 (C:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

SCOPe Domain Coordinates for d3jwnc2:

Click to download the PDB-style file with coordinates for d3jwnc2.
(The format of our PDB-style files is described here.)

Timeline for d3jwnc2: