PDB entry 3jwn

View 3jwn on RCSB PDB site
Description: Complex of FimC, FimF, FimG and FimH
Class: protein binding/cell adhesion
Keywords: fimbria, cell adhesion, fimh, fimc, fimf,fimg, chaperone, fibrium, immunoglobulin domain, Fimbrium, Periplasm, Disulfide bond, protein binding-cell adhesion COMPLEX
Deposited on 2009-09-18, released 2010-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.245
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:83333]
    Gene: b4316, fimC, JW4279
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jwnc1, d3jwnc2
  • Chain 'E':
    Compound: Protein fimF
    Species: Escherichia coli [TaxId:83333]
    Gene: b4318, fimF, JW4281
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08189 (0-153)
      • conflict (88)
  • Chain 'F':
    Compound: Protein fimF
    Species: Escherichia coli [TaxId:83333]
    Gene: b4318, fimF, JW4281
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08189 (0-153)
      • conflict (88)
  • Chain 'G':
    Compound: Protein fimG
    Species: Escherichia coli [TaxId:83333]
    Gene: b4319, fimG, JW4282
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:488477]
    Gene: ECP_4655, fimh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jwnh1, d3jwnh2
  • Chain 'I':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:83333]
    Gene: b4316, fimC, JW4279
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jwni1, d3jwni2
  • Chain 'K':
    Compound: Protein fimF
    Species: Escherichia coli [TaxId:83333]
    Gene: b4318, fimF, JW4281
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08189 (0-153)
      • conflict (88)
  • Chain 'L':
    Compound: Protein fimF
    Species: Escherichia coli [TaxId:83333]
    Gene: b4318, fimF, JW4281
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08189 (0-153)
      • conflict (88)
  • Chain 'M':
    Compound: Protein fimG
    Species: Escherichia coli [TaxId:83333]
    Gene: b4319, fimG, JW4282
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: FimH PROTEIN
    Species: Escherichia coli [TaxId:488477]
    Gene: ECP_4655, fimh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3jwnn1, d3jwnn2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3jwnC (C:)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jwnC (C:)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmentlqlaiisriklyyrpaklalppdq
    aaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsdagsnit
    yrtindygaltpkmtgvme
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jwnH (H:)
    facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3jwnI (I:)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jwnI (I:)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsentlqlaiisriklyyrpaklalppdqa
    aeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsdagsnity
    rtindygaltpkmtgvme
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3jwnN (N:)
    facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvptggcdvsardvtvtlpdypgsvp
    ipltvycaksqnlgyylsgttadagnsiftntasfspaqgvgvqltrngtiipanntvsl
    gavgtsavslgltanyartggqvtagnvqsiigvtfvyq