SCOPe 2.08: Domain d3jwnh1: 3jwn H:1-158

Lineage for d3jwnh1 (3jwn H:1-158)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein automated matches [190569] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:488477] [232652] (2 PDB entries)

8. Domain d3jwnh1: 3jwn H:1-158 [232653]
   Other proteins in same PDB: d3jwnc1, d3jwnc2, d3jwne_, d3jwnf_, d3jwni1, d3jwni2, d3jwnk_, d3jwnl_
   automated match to d4av5a_
   complexed with gol

Details for d3jwnh1

PDB Entry: 3jwn, 2.69 Å

PDB Description: Complex of FimC, FimF, FimG and FimH

PDB Compounds: (H:) FimH PROTEIN

SCOPe Domain Sequences for d3jwnh1:

Sequence; same for both SEQRES and ATOM records:

>d3jwnh1 b.2.3.2 (H:1-158) automated matches {Escherichia coli [TaxId: 488477]}
facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d3jwnh1:

• d3jwnh1 first appeared in SCOPe 2.03
  
• d3jwnh1 appears in SCOPe 2.07