![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
![]() | Protein automated matches [190503] (10 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [346217] (6 PDB entries) |
![]() | Domain d3jwne_: 3jwn E: [343811] Other proteins in same PDB: d3jwnc1, d3jwnc2, d3jwnh1, d3jwnh2, d3jwni1, d3jwni2, d3jwnn1, d3jwnn2 automated match to d5lp9a_ complexed with gol |
PDB Entry: 3jwn (more details), 2.69 Å
SCOPe Domain Sequences for d3jwne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jwne_ b.2.3.0 (E:) automated matches {Escherichia coli [TaxId: 83333]} adstitirgyvrdngcsvaaestnftvdlmenaakqfnnigattpvvpfrillspcgnav savkvgftgvadshnanllalentvsaaaglgiqllneqqnqiplnapssalswttltpg kpntlnfyarlmatqvpvtaghinatatftleyq
Timeline for d3jwne_: