SCOPe 2.08: Domain d5w1we1: 5w1w E:3-129

Lineage for d5w1we1 (5w1w E:3-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5w1we1: 5w1w E:3-129 [339953]
   Other proteins in same PDB: d5w1wa1, d5w1wb1, d5w1wb2, d5w1wd2, d5w1wf1, d5w1wf2, d5w1wg1, d5w1wg2, d5w1wi2, d5w1wk1, d5w1wl1, d5w1wl2, d5w1wn2, d5w1wp1, d5w1wq1, d5w1wq2, d5w1ws2
   automated match to d2nw2b1

Details for d5w1we1

PDB Entry: 5w1w, 3.1 Å

PDB Description: structure of the hla-e-vmaprtlvl/gf4 tcr complex

PDB Compounds: (E:) GF4 T cell receptor beta chain

SCOPe Domain Sequences for d5w1we1:

Sequence; same for both SEQRES and ATOM records:

>d5w1we1 b.1.1.0 (E:3-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnile
rfsaqqfpdlhselnlsslelgdsalyfcassanpgdssneklffgsgtqlsvle

Timeline for d5w1we1:

• d5w1we1 first appeared in SCOPe 2.06
  
• d5w1we1 appears in SCOPe 2.07