Lineage for d5w1wd1 (5w1w D:3-129)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1083 PDB entries)
  8. 2357587Domain d5w1wd1: 5w1w D:3-129 [339911]
    Other proteins in same PDB: d5w1wa1, d5w1wb1, d5w1wb2, d5w1wd2, d5w1wf1, d5w1wf2, d5w1wg1, d5w1wg2, d5w1wi2, d5w1wk1, d5w1wl1, d5w1wl2, d5w1wn2, d5w1wp1, d5w1wq1, d5w1wq2, d5w1ws2
    automated match to d2f54d1

Details for d5w1wd1

PDB Entry: 5w1w (more details), 3.1 Å

PDB Description: structure of the hla-e-vmaprtlvl/gf4 tcr complex
PDB Compounds: (D:) GF4 T cell receptor alpha chain

SCOPe Domain Sequences for d5w1wd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w1wd1 b.1.1.0 (D:3-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlnqspqsmfiqegedvsmnctsssifntwlwykqdpgegpvllialykageltsngrlt
aqfgitrkdsflnisasipsdvgiyfcagqplggsnykltfgkgtlltvnpn

SCOPe Domain Coordinates for d5w1wd1:

Click to download the PDB-style file with coordinates for d5w1wd1.
(The format of our PDB-style files is described here.)

Timeline for d5w1wd1: