SCOPe 2.08: Domain d5w1wf2: 5w1w F:182-276

Lineage for d5w1wf2 (5w1w F:182-276)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d5w1wf2: 5w1w F:182-276 [339897]
   Other proteins in same PDB: d5w1wa1, d5w1wa2, d5w1wb1, d5w1wb2, d5w1wd1, d5w1wd2, d5w1we1, d5w1we2, d5w1wf1, d5w1wg1, d5w1wg2, d5w1wi1, d5w1wi2, d5w1wj1, d5w1wj2, d5w1wk1, d5w1wk2, d5w1wl1, d5w1wl2, d5w1wn1, d5w1wn2, d5w1wo1, d5w1wo2, d5w1wp1, d5w1wp2, d5w1wq1, d5w1wq2, d5w1ws1, d5w1ws2, d5w1wt1, d5w1wt2
   automated match to d1efxa1

Details for d5w1wf2

PDB Entry: 5w1w, 3.1 Å

PDB Description: structure of the hla-e-vmaprtlvl/gf4 tcr complex

PDB Compounds: (F:) HLA class I histocompatibility antigen, alpha chain E

SCOPe Domain Sequences for d5w1wf2:

Sequence, based on SEQRES records:

>d5w1wf2 b.1.1.2 (F:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepvtlrwkp

Sequence, based on observed residues (ATOM records):

>d5w1wf2 b.1.1.2 (F:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
leppkthvthhpisdheatlrcwalgfypaeitltwqqghtqdtelvetrpagdgtfqkw
aavvvpsgeeqrytchvqheglpepvtlrwkp

Timeline for d5w1wf2:

• d5w1wf2 first appeared in SCOPe 2.06
  
• d5w1wf2 appears in SCOPe 2.07