Lineage for d5w1wo2 (5w1w O:130-257)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759293Domain d5w1wo2: 5w1w O:130-257 [339928]
    Other proteins in same PDB: d5w1wa1, d5w1wb1, d5w1wb2, d5w1wd2, d5w1wf1, d5w1wf2, d5w1wg1, d5w1wg2, d5w1wi2, d5w1wk1, d5w1wl1, d5w1wl2, d5w1wn2, d5w1wp1, d5w1wq1, d5w1wq2, d5w1ws2
    automated match to d2nw2b2

Details for d5w1wo2

PDB Entry: 5w1w (more details), 3.1 Å

PDB Description: structure of the hla-e-vmaprtlvl/gf4 tcr complex
PDB Compounds: (O:) GF4 T cell receptor beta chain

SCOPe Domain Sequences for d5w1wo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w1wo2 b.1.1.0 (O:130-257) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlnkvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d5w1wo2:

Click to download the PDB-style file with coordinates for d5w1wo2.
(The format of our PDB-style files is described here.)

Timeline for d5w1wo2: