![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d5w1wo1: 5w1w O:3-129 [339927] Other proteins in same PDB: d5w1wa1, d5w1wb1, d5w1wb2, d5w1wd2, d5w1wf1, d5w1wf2, d5w1wg1, d5w1wg2, d5w1wi2, d5w1wk1, d5w1wl1, d5w1wl2, d5w1wn2, d5w1wp1, d5w1wq1, d5w1wq2, d5w1ws2 automated match to d2nw2b1 |
PDB Entry: 5w1w (more details), 3.1 Å
SCOPe Domain Sequences for d5w1wo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w1wo1 b.1.1.0 (O:3-129) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnile rfsaqqfpdlhselnlsslelgdsalyfcassanpgdssneklffgsgtqlsvle
Timeline for d5w1wo1:
![]() Domains from other chains: (mouse over for more information) d5w1wa1, d5w1wa2, d5w1wb1, d5w1wb2, d5w1wd1, d5w1wd2, d5w1we1, d5w1we2, d5w1wf1, d5w1wf2, d5w1wg1, d5w1wg2, d5w1wi1, d5w1wi2, d5w1wj1, d5w1wj2, d5w1wk1, d5w1wk2, d5w1wl1, d5w1wl2, d5w1wn1, d5w1wn2, d5w1wp1, d5w1wp2, d5w1wq1, d5w1wq2, d5w1ws1, d5w1ws2, d5w1wt1, d5w1wt2 |