SCOPe 2.08: Domain d5w1wp1: 5w1w P:2-181

Lineage for d5w1wp1 (5w1w P:2-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-CW3 [TaxId:9606] [54477] (2 PDB entries)

8. Domain d5w1wp1: 5w1w P:2-181 [339922]
   Other proteins in same PDB: d5w1wa2, d5w1wb1, d5w1wb2, d5w1wd1, d5w1wd2, d5w1we1, d5w1we2, d5w1wf2, d5w1wg1, d5w1wg2, d5w1wi1, d5w1wi2, d5w1wj1, d5w1wj2, d5w1wk2, d5w1wl1, d5w1wl2, d5w1wn1, d5w1wn2, d5w1wo1, d5w1wo2, d5w1wp2, d5w1wq1, d5w1wq2, d5w1ws1, d5w1ws2, d5w1wt1, d5w1wt2
   automated match to d1efxa2

Details for d5w1wp1

PDB Entry: 5w1w, 3.1 Å

PDB Description: structure of the hla-e-vmaprtlvl/gf4 tcr complex

PDB Compounds: (P:) HLA class I histocompatibility antigen, alpha chain E

SCOPe Domain Sequences for d5w1wp1:

Sequence; same for both SEQRES and ATOM records:

>d5w1wp1 d.19.1.1 (P:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-CW3 [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

Timeline for d5w1wp1:

• d5w1wp1 first appeared in SCOPe 2.06
  
• d5w1wp1 appears in SCOPe 2.07