Lineage for d5w1wf1 (5w1w F:2-181)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2506604Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 2506891Species Human (Homo sapiens), HLA-CW3 [TaxId:9606] [54477] (2 PDB entries)
  8. 2506894Domain d5w1wf1: 5w1w F:2-181 [339896]
    Other proteins in same PDB: d5w1wa2, d5w1wb1, d5w1wb2, d5w1wd1, d5w1wd2, d5w1we1, d5w1we2, d5w1wf2, d5w1wg1, d5w1wg2, d5w1wi1, d5w1wi2, d5w1wj1, d5w1wj2, d5w1wk2, d5w1wl1, d5w1wl2, d5w1wn1, d5w1wn2, d5w1wo1, d5w1wo2, d5w1wp2, d5w1wq1, d5w1wq2, d5w1ws1, d5w1ws2, d5w1wt1, d5w1wt2
    automated match to d1efxa2

Details for d5w1wf1

PDB Entry: 5w1w (more details), 3.1 Å

PDB Description: structure of the hla-e-vmaprtlvl/gf4 tcr complex
PDB Compounds: (F:) HLA class I histocompatibility antigen, alpha chain E

SCOPe Domain Sequences for d5w1wf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w1wf1 d.19.1.1 (F:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-CW3 [TaxId: 9606]}
shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd
retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk
dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh

SCOPe Domain Coordinates for d5w1wf1:

Click to download the PDB-style file with coordinates for d5w1wf1.
(The format of our PDB-style files is described here.)

Timeline for d5w1wf1: