Lineage for d5x9gd1 (5x9g D:5-131)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334559Superfamily a.118.26: MgtE N-terminal domain-like [158791] (2 families) (S)
    made of short helices; approximately 2.5 helices per turn of superhelix
    automatically mapped to Pfam PF03448
  5. 2334572Family a.118.26.0: automated matches [231669] (1 protein)
    not a true family
  6. 2334573Protein automated matches [231679] (2 species)
    not a true protein
  7. 2334576Species Thermus thermophilus [TaxId:300852] [338061] (1 PDB entry)
  8. 2334580Domain d5x9gd1: 5x9g D:5-131 [338161]
    Other proteins in same PDB: d5x9ga2, d5x9gb2, d5x9gc2, d5x9gd2
    automated match to d2yvxa1
    complexed with atp, mg

Details for d5x9gd1

PDB Entry: 5x9g (more details), 3 Å

PDB Description: crystal structure of the cytosolic domain of the mg2+ channel mgte in complex with atp
PDB Compounds: (D:) Magnesium transporter MgtE

SCOPe Domain Sequences for d5x9gd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x9gd1 a.118.26.0 (D:5-131) automated matches {Thermus thermophilus [TaxId: 300852]}
lavslqealqegdtralrevleeihpqdllalwdelkgehryvvltllpkakaaevlshl
speeqaeylktlppwrlreileelslddladalqavrkedpayfqrlkdlldprtraeve
alaryee

SCOPe Domain Coordinates for d5x9gd1:

Click to download the PDB-style file with coordinates for d5x9gd1.
(The format of our PDB-style files is described here.)

Timeline for d5x9gd1: