![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
![]() | Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
![]() | Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
![]() | Protein automated matches [190627] (7 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [338063] (1 PDB entry) |
![]() | Domain d5x9gd2: 5x9g D:132-252 [338162] Other proteins in same PDB: d5x9ga1, d5x9gb1, d5x9gc1, d5x9gd1 automated match to d2zy9a2 complexed with atp, mg |
PDB Entry: 5x9g (more details), 3 Å
SCOPe Domain Sequences for d5x9gd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x9gd2 d.37.1.1 (D:132-252) automated matches {Thermus thermophilus [TaxId: 300852]} deagglmtpeyvavregmtveevlrflrraapdaetiyyiyvvdekgrlkgvlslrdliv adprtrvaeimnpkvvyvrtdtdqeevarlmadydftvlpvvdeegrlvgivtvddvldv l
Timeline for d5x9gd2: