| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.26: MgtE N-terminal domain-like [158791] (2 families) ![]() made of short helices; approximately 2.5 helices per turn of superhelix automatically mapped to Pfam PF03448 |
| Family a.118.26.0: automated matches [231669] (1 protein) not a true family |
| Protein automated matches [231679] (2 species) not a true protein |
| Species Thermus thermophilus [TaxId:300852] [338061] (1 PDB entry) |
| Domain d5x9ga1: 5x9g A:5-131 [338062] Other proteins in same PDB: d5x9ga2, d5x9gb2, d5x9gc2, d5x9gd2 automated match to d2yvxa1 complexed with atp, mg |
PDB Entry: 5x9g (more details), 3 Å
SCOPe Domain Sequences for d5x9ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x9ga1 a.118.26.0 (A:5-131) automated matches {Thermus thermophilus [TaxId: 300852]}
lavslqealqegdtralrevleeihpqdllalwdelkgehryvvltllpkakaaevlshl
speeqaeylktlppwrlreileelslddladalqavrkedpayfqrlkdlldprtraeve
alaryee
Timeline for d5x9ga1: