Lineage for d5x9gc1 (5x9g C:6-131)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727528Superfamily a.118.26: MgtE N-terminal domain-like [158791] (2 families) (S)
    made of short helices; approximately 2.5 helices per turn of superhelix
    automatically mapped to Pfam PF03448
  5. 2727541Family a.118.26.0: automated matches [231669] (1 protein)
    not a true family
  6. 2727542Protein automated matches [231679] (2 species)
    not a true protein
  7. 2727545Species Thermus thermophilus [TaxId:300852] [338061] (1 PDB entry)
  8. 2727548Domain d5x9gc1: 5x9g C:6-131 [338128]
    Other proteins in same PDB: d5x9ga2, d5x9gb2, d5x9gc2, d5x9gd2
    automated match to d2yvxa1
    complexed with atp, mg

Details for d5x9gc1

PDB Entry: 5x9g (more details), 3 Å

PDB Description: crystal structure of the cytosolic domain of the mg2+ channel mgte in complex with atp
PDB Compounds: (C:) Magnesium transporter MgtE

SCOPe Domain Sequences for d5x9gc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x9gc1 a.118.26.0 (C:6-131) automated matches {Thermus thermophilus [TaxId: 300852]}
avslqealqegdtralrevleeihpqdllalwdelkgehryvvltllpkakaaevlshls
peeqaeylktlppwrlreileelslddladalqavrkedpayfqrlkdlldprtraevea
laryee

SCOPe Domain Coordinates for d5x9gc1:

Click to download the PDB-style file with coordinates for d5x9gc1.
(The format of our PDB-style files is described here.)

Timeline for d5x9gc1: