SCOPe 2.08: Domain d5x9ga2: 5x9g A:132-252

Lineage for d5x9ga2 (5x9g A:132-252)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein automated matches [190627] (7 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [338063] (1 PDB entry)

8. Domain d5x9ga2: 5x9g A:132-252 [338064]
   Other proteins in same PDB: d5x9ga1, d5x9gb1, d5x9gc1, d5x9gd1
   automated match to d2zy9a2
   complexed with atp, mg

Details for d5x9ga2

PDB Entry: 5x9g, 3 Å

PDB Description: crystal structure of the cytosolic domain of the mg2+ channel mgte in complex with atp

PDB Compounds: (A:) Magnesium transporter MgtE

SCOPe Domain Sequences for d5x9ga2:

Sequence; same for both SEQRES and ATOM records:

>d5x9ga2 d.37.1.1 (A:132-252) automated matches {Thermus thermophilus [TaxId: 300852]}
deagglmtpeyvavregmtveevlrflrraapdaetiyyiyvvdekgrlkgvlslrdliv
adprtrvaeimnpkvvyvrtdtdqeevarlmadydftvlpvvdeegrlvgivtvddvldv
l

Timeline for d5x9ga2:

• d5x9ga2 first appeared in SCOPe 2.06
  
• d5x9ga2 appears in SCOPe 2.07